ARHGAP25 anticorps (Middle Region)

N° du produit ABIN631594

Cet anticorps Lapin Polyclonal détecte spécifiquement ARHGAP25 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour ARHGAP25 anticorps (Middle Region) (ABIN631594)

Antigène: ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARHGAP25 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ARHGAP25 anticorps

Épitope: Middle Region

Specificité: ARHGAP25 antibody was raised against the middle region of ARHGAP25

Purification: Affinity purified

Immunogène: ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARHGAP25 Blocking Peptide, (ABIN5612149), is also available for use as a blocking control in assays to test for specificity of this ARHGAP25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARHGAP25

Antigène: ARHGAP25 (rho GTPase Activating Protein 25 (ARHGAP25))

Autre désignation: ARHGAP25

Sujet: ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.

Poids moléculaire: 70 kDa (MW of target protein)